Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (7 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries) |
Domain d1rzkc2: 1rzk C:98-181 [98206] Other proteins in same PDB: d1rzkc1, d1rzkg_, d1rzkh1, d1rzkh2, d1rzkl1, d1rzkl2 domain 2 complexed with nag; mutant |
PDB Entry: 1rzk (more details), 2.9 Å
SCOP Domain Sequences for d1rzkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzkc2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens)} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvlafqk
Timeline for d1rzkc2: