Lineage for d1rzkc2 (1rzk C:98-181)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 366293Family b.1.1.3: C2 set domains [49142] (7 proteins)
  6. 366303Protein CD4 C2-set domains [49149] (2 species)
  7. 366304Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries)
  8. 366314Domain d1rzkc2: 1rzk C:98-181 [98206]
    Other proteins in same PDB: d1rzkc1, d1rzkg_, d1rzkh1, d1rzkh2, d1rzkl1, d1rzkl2
    domain 2
    complexed with nag; mutant

Details for d1rzkc2

PDB Entry: 1rzk (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1rzkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzkc2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens)}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOP Domain Coordinates for d1rzkc2:

Click to download the PDB-style file with coordinates for d1rzkc2.
(The format of our PDB-style files is described here.)

Timeline for d1rzkc2: