![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
![]() | Protein CD4 V-set domains [48737] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries) |
![]() | Domain d1rzkc1: 1rzk C:1-97 [98205] Other proteins in same PDB: d1rzkc2, d1rzkg_, d1rzkh1, d1rzkh2, d1rzkl1, d1rzkl2 domain 1 complexed with nag; mutant |
PDB Entry: 1rzk (more details), 2.9 Å
SCOP Domain Sequences for d1rzkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzkc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens)} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1rzkc1: