Lineage for d1rzjl2 (1rzj L:110-212)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786055Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
    SQ NA # humanized antibody
    Uniprot P01834 # KAC_HUMAN Ig kappa chain C region
    SQ P01834 # KAC_HUMAN Ig kappa chain C region.
    SQ NA # engineered antibody
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 786171Domain d1rzjl2: 1rzj L:110-212 [98204]
    Other proteins in same PDB: d1rzjc1, d1rzjc2, d1rzjg_, d1rzjh1, d1rzjh2, d1rzjl1
    part of anti HIV-1 gp120-reactive Fab 17B
    complexed with fuc, ioh, nag; mutant

Details for d1rzjl2

PDB Entry: 1rzj (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (L:) antibody 17b, light chain

SCOP Domain Sequences for d1rzjl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzjl2 b.1.1.2 (L:110-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1rzjl2:

Click to download the PDB-style file with coordinates for d1rzjl2.
(The format of our PDB-style files is described here.)

Timeline for d1rzjl2: