Lineage for d1rzjl1 (1rzj L:1-109)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756776Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)
  8. 1756811Domain d1rzjl1: 1rzj L:1-109 [98203]
    Other proteins in same PDB: d1rzjc1, d1rzjc2, d1rzjg_, d1rzjh1, d1rzjh2, d1rzjl2
    part of anti HIV-1 gp120 Fab 17B
    complexed with ipa, nag, ndg

Details for d1rzjl1

PDB Entry: 1rzj (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (L:) antibody 17b, light chain

SCOPe Domain Sequences for d1rzjl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzjl1 b.1.1.1 (L:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrt

SCOPe Domain Coordinates for d1rzjl1:

Click to download the PDB-style file with coordinates for d1rzjl1.
(The format of our PDB-style files is described here.)

Timeline for d1rzjl1: