Lineage for d1rzjh1 (1rzj H:1-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1755760Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 1755797Domain d1rzjh1: 1rzj H:1-113 [98201]
    Other proteins in same PDB: d1rzjc1, d1rzjc2, d1rzjg_, d1rzjh2, d1rzjl1, d1rzjl2
    part of anti HIV-1 gp120-reactive Fab 17B
    complexed with ipa, nag, ndg

Details for d1rzjh1

PDB Entry: 1rzj (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (H:) antibody 17b, heavy chain

SCOPe Domain Sequences for d1rzjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzjh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvss

SCOPe Domain Coordinates for d1rzjh1:

Click to download the PDB-style file with coordinates for d1rzjh1.
(The format of our PDB-style files is described here.)

Timeline for d1rzjh1: