Lineage for d1rzjc2 (1rzj C:98-181)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764328Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 1764338Protein CD4 C2-set domains [49149] (2 species)
  7. 1764339Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries)
  8. 1764355Domain d1rzjc2: 1rzj C:98-181 [98199]
    Other proteins in same PDB: d1rzjc1, d1rzjg_, d1rzjh1, d1rzjh2, d1rzjl1, d1rzjl2
    domain 2
    complexed with ipa, nag, ndg

Details for d1rzjc2

PDB Entry: 1rzj (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1rzjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzjc2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOPe Domain Coordinates for d1rzjc2:

Click to download the PDB-style file with coordinates for d1rzjc2.
(The format of our PDB-style files is described here.)

Timeline for d1rzjc2: