SCOPe 2.08: Domain d1rzjc2: 1rzj C:98-181

Lineage for d1rzjc2 (1rzj C:98-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)

8. Domain d1rzjc2: 1rzj C:98-181 [98199]
   Other proteins in same PDB: d1rzjc1, d1rzjg_, d1rzjh1, d1rzjh2, d1rzjl1, d1rzjl2
   domain 2
   complexed with ipa, nag

Details for d1rzjc2

PDB Entry: 1rzj, 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1rzjc2:

Sequence; same for both SEQRES and ATOM records:

>d1rzjc2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

Timeline for d1rzjc2:

• d1rzjc2 first appeared in SCOP 1.67
  
• d1rzjc2 appears in SCOPe 2.07