Lineage for d1rzjc1 (1rzj C:1-97)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546488Protein CD4 V-set domains [48737] (2 species)
  7. 546489Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries)
  8. 546495Domain d1rzjc1: 1rzj C:1-97 [98198]
    Other proteins in same PDB: d1rzjc2, d1rzjg_, d1rzjh1, d1rzjh2, d1rzjl1, d1rzjl2
    domain 1
    complexed with fuc, ioh, nag; mutant

Details for d1rzjc1

PDB Entry: 1rzj (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1rzjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzjc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1rzjc1:

Click to download the PDB-style file with coordinates for d1rzjc1.
(The format of our PDB-style files is described here.)

Timeline for d1rzjc1: