SCOP 1.67: Domain d1rzjc1: 1rzj C:1-97

Lineage for d1rzjc1 (1rzj C:1-97)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries)

8. Domain d1rzjc1: 1rzj C:1-97 [98198]
   Other proteins in same PDB: d1rzjc2, d1rzjg_, d1rzjh1, d1rzjh2, d1rzjl1, d1rzjl2
   domain 1
   complexed with fuc, ioh, nag; mutant

Details for d1rzjc1

PDB Entry: 1rzj, 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1rzjc1:

Sequence; same for both SEQRES and ATOM records:

>d1rzjc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1rzjc1:

• d1rzjc1 is new in SCOP 1.67
  
• d1rzjc1 appears in SCOP 1.69
  
• d1rzjc1 appears in the current release, SCOPe 2.08