Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries) |
Domain d1rzjc1: 1rzj C:1-97 [98198] Other proteins in same PDB: d1rzjc2, d1rzjg_, d1rzjh1, d1rzjh2, d1rzjl1, d1rzjl2 domain 1 complexed with fuc, ioh, nag; mutant |
PDB Entry: 1rzj (more details), 2.2 Å
SCOP Domain Sequences for d1rzjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzjc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens)} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1rzjc1: