| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
| Domain d1rzip2: 1rzi P:114-213 [98197] Other proteins in same PDB: d1rzia1, d1rzia2, d1rzib1, d1rzic1, d1rzic2, d1rzid1, d1rzie1, d1rzie2, d1rzif1, d1rzig1, d1rzig2, d1rzih1, d1rzii1, d1rzii2, d1rzij1, d1rzik1, d1rzik2, d1rzil1, d1rzim1, d1rzim2, d1rzin1, d1rzio1, d1rzio2, d1rzip1 part of anti HIV-1 gp120-reactive Fab 47E |
PDB Entry: 1rzi (more details), 2.9 Å
SCOP Domain Sequences for d1rzip2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzip2 b.1.1.2 (P:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d1rzip2:
View in 3DDomains from other chains: (mouse over for more information) d1rzia1, d1rzia2, d1rzib1, d1rzib2, d1rzic1, d1rzic2, d1rzid1, d1rzid2, d1rzie1, d1rzie2, d1rzif1, d1rzif2, d1rzig1, d1rzig2, d1rzih1, d1rzih2, d1rzii1, d1rzii2, d1rzij1, d1rzij2, d1rzik1, d1rzik2, d1rzil1, d1rzil2, d1rzim1, d1rzim2, d1rzin1, d1rzin2, d1rzio1, d1rzio2 |