SCOPe 2.05: Domain d1rzih2: 1rzi H:114-213

Lineage for d1rzih2 (1rzi H:114-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1rzih2: 1rzi H:114-213 [98181]
   Other proteins in same PDB: d1rzia1, d1rzia2, d1rzib1, d1rzic1, d1rzic2, d1rzid1, d1rzie1, d1rzie2, d1rzif1, d1rzig1, d1rzig2, d1rzih1, d1rzii1, d1rzii2, d1rzij1, d1rzik1, d1rzik2, d1rzil1, d1rzim1, d1rzim2, d1rzin1, d1rzio1, d1rzio2, d1rzip1
   part of anti HIV-1 gp120-reactive Fab 47E

Details for d1rzih2

PDB Entry: 1rzi, 2.9 Å

PDB Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab

PDB Compounds: (H:) Fab 47e heavy chain

SCOPe Domain Sequences for d1rzih2:

Sequence; same for both SEQRES and ATOM records:

>d1rzih2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1rzih2:

• d1rzih2 first appeared in SCOP 1.67
  
• d1rzih2 appears in SCOPe 2.04
  
• d1rzih2 appears in SCOPe 2.06
  
• d1rzih2 appears in the current release, SCOPe 2.08