Lineage for d1rzig1 (1rzi G:2-107)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930478Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (18 PDB entries)
  8. 930515Domain d1rzig1: 1rzi G:2-107 [98178]
    Other proteins in same PDB: d1rzia2, d1rzib1, d1rzib2, d1rzic2, d1rzid1, d1rzid2, d1rzie2, d1rzif1, d1rzif2, d1rzig2, d1rzih1, d1rzih2, d1rzii2, d1rzij1, d1rzij2, d1rzik2, d1rzil1, d1rzil2, d1rzim2, d1rzin1, d1rzin2, d1rzio2, d1rzip1, d1rzip2
    part of anti HIV-1 gp120-reactive Fab 47E

Details for d1rzig1

PDB Entry: 1rzi (more details), 2.9 Å

PDB Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab
PDB Compounds: (G:) Fab 47e light chain

SCOPe Domain Sequences for d1rzig1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzig1 b.1.1.1 (G:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleik

SCOPe Domain Coordinates for d1rzig1:

Click to download the PDB-style file with coordinates for d1rzig1.
(The format of our PDB-style files is described here.)

Timeline for d1rzig1: