Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1rzif2: 1rzi F:114-214 [98177] Other proteins in same PDB: d1rzia1, d1rzia2, d1rzib1, d1rzic1, d1rzic2, d1rzid1, d1rzie1, d1rzie2, d1rzif1, d1rzig1, d1rzig2, d1rzih1, d1rzii1, d1rzii2, d1rzij1, d1rzik1, d1rzik2, d1rzil1, d1rzim1, d1rzim2, d1rzin1, d1rzio1, d1rzio2, d1rzip1 |
PDB Entry: 1rzi (more details), 2.9 Å
SCOP Domain Sequences for d1rzif2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzif2 b.1.1.2 (F:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1rzif2:
View in 3D Domains from other chains: (mouse over for more information) d1rzia1, d1rzia2, d1rzib1, d1rzib2, d1rzic1, d1rzic2, d1rzid1, d1rzid2, d1rzie1, d1rzie2, d1rzig1, d1rzig2, d1rzih1, d1rzih2, d1rzii1, d1rzii2, d1rzij1, d1rzij2, d1rzik1, d1rzik2, d1rzil1, d1rzil2, d1rzim1, d1rzim2, d1rzin1, d1rzin2, d1rzio1, d1rzio2, d1rzip1, d1rzip2 |