SCOP 1.69: Domain d1rzif2: 1rzi F:114-214

Lineage for d1rzif2 (1rzi F:114-214)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1rzif2: 1rzi F:114-214 [98177]
   Other proteins in same PDB: d1rzia1, d1rzia2, d1rzib1, d1rzic1, d1rzic2, d1rzid1, d1rzie1, d1rzie2, d1rzif1, d1rzig1, d1rzig2, d1rzih1, d1rzii1, d1rzii2, d1rzij1, d1rzik1, d1rzik2, d1rzil1, d1rzim1, d1rzim2, d1rzin1, d1rzio1, d1rzio2, d1rzip1

Details for d1rzif2

PDB Entry: 1rzi, 2.9 Å

PDB Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab

SCOP Domain Sequences for d1rzif2:

Sequence; same for both SEQRES and ATOM records:

>d1rzif2 b.1.1.2 (F:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1rzif2:

• d1rzif2 first appeared in SCOP 1.67
  
• d1rzif2 appears in SCOP 1.71
  
• d1rzif2 appears in the current release, SCOPe 2.08