SCOP 1.67: Domain d1rzid1: 1rzi D:1-113

Lineage for d1rzid1 (1rzi D:1-113)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (16 PDB entries)

8. Domain d1rzid1: 1rzi D:1-113 [98172]
   Other proteins in same PDB: d1rzia1, d1rzia2, d1rzib2, d1rzic1, d1rzic2, d1rzid2, d1rzie1, d1rzie2, d1rzif2, d1rzig1, d1rzig2, d1rzih2, d1rzii1, d1rzii2, d1rzij2, d1rzik1, d1rzik2, d1rzil2, d1rzim1, d1rzim2, d1rzin2, d1rzio1, d1rzio2, d1rzip2

Details for d1rzid1

PDB Entry: 1rzi, 2.9 Å

PDB Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab

SCOP Domain Sequences for d1rzid1:

Sequence, based on SEQRES records:

>d1rzid1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
qgttvtvas

Sequence, based on observed residues (ATOM records):

>d1rzid1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvas

Timeline for d1rzid1:

• d1rzid1 is new in SCOP 1.67
  
• d1rzid1 appears in SCOP 1.69
  
• d1rzid1 appears in the current release, SCOPe 2.08