Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (39 PDB entries) |
Domain d1rzhm_: 1rzh M: [98165] Other proteins in same PDB: d1rzhh1, d1rzhh2, d1rzhl_ |
PDB Entry: 1rzh (more details), 1.8 Å
SCOP Domain Sequences for d1rzhm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzhm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggeceleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn h
Timeline for d1rzhm_: