Lineage for d1rzhm_ (1rzh M:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 520396Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 520397Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 520398Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 520460Protein M (medium) subunit [81481] (3 species)
  7. 520461Species Rhodobacter sphaeroides [TaxId:1063] [81479] (39 PDB entries)
  8. 520462Domain d1rzhm_: 1rzh M: [98165]
    Other proteins in same PDB: d1rzhh1, d1rzhh2, d1rzhl_

Details for d1rzhm_

PDB Entry: 1rzh (more details), 1.8 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg m233 replaced with cys in the charge-neutral dqaqb state (trigonal form)

SCOP Domain Sequences for d1rzhm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzhm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggeceleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
h

SCOP Domain Coordinates for d1rzhm_:

Click to download the PDB-style file with coordinates for d1rzhm_.
(The format of our PDB-style files is described here.)

Timeline for d1rzhm_: