Lineage for d1rzhh1 (1rzh H:36-248)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790504Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1790505Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1790506Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
    Uniprot P11846
  8. 1790508Domain d1rzhh1: 1rzh H:36-248 [98162]
    Other proteins in same PDB: d1rzhh2, d1rzhl_, d1rzhm_
    complexed with bcl, bph, cdl, fe2, gol, hto, lda, po4, spo, u10; mutant

Details for d1rzhh1

PDB Entry: 1rzh (more details), 1.8 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg m233 replaced with cys in the charge-neutral dqaqb state (trigonal form)
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1rzhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzhh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

SCOPe Domain Coordinates for d1rzhh1:

Click to download the PDB-style file with coordinates for d1rzhh1.
(The format of our PDB-style files is described here.)

Timeline for d1rzhh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rzhh2