SCOPe 2.01: Domain d1rzgb2: 1rzg B:108-213

Lineage for d1rzgb2 (1rzg B:108-213)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1rzgb2: 1rzg B:108-213 [98157]
   Other proteins in same PDB: d1rzga1, d1rzga2, d1rzgb1, d1rzgc1, d1rzgc2, d1rzgd1
   part of anti HIV-1 gp120-reactive Fab 412D
   complexed with cys, suc

Details for d1rzgb2

PDB Entry: 1rzg, 2 Å

PDB Description: crystal structure of human anti-hiv-1 gp120 reactive antibody 412d

PDB Compounds: (B:) Fab 412d heavy chain

SCOPe Domain Sequences for d1rzgb2:

Sequence; same for both SEQRES and ATOM records:

>d1rzgb2 b.1.1.2 (B:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhklyacevthqglsspvtksfnrge

Timeline for d1rzgb2:

• d1rzgb2 first appeared in SCOP 1.67
  
• d1rzgb2 appears in SCOP 1.75
  
• d1rzgb2 appears in SCOPe 2.02
  
• d1rzgb2 appears in the current release, SCOPe 2.08