Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (74 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1rzgb2: 1rzg B:108-213 [98157] Other proteins in same PDB: d1rzga1, d1rzga2, d1rzgb1, d1rzgc1, d1rzgc2, d1rzgd1 |
PDB Entry: 1rzg (more details), 2 Å
SCOP Domain Sequences for d1rzgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzgb2 b.1.1.2 (B:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhklyacevthqglsspvtksfnrge
Timeline for d1rzgb2: