Lineage for d1rzgb2 (1rzg B:108-213)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365640Species Human (Homo sapiens) [TaxId:9606] [88569] (74 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365651Domain d1rzgb2: 1rzg B:108-213 [98157]
    Other proteins in same PDB: d1rzga1, d1rzga2, d1rzgb1, d1rzgc1, d1rzgc2, d1rzgd1

Details for d1rzgb2

PDB Entry: 1rzg (more details), 2 Å

PDB Description: crystal structure of human anti-hiv-1 gp120 reactive antibody 412d

SCOP Domain Sequences for d1rzgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzgb2 b.1.1.2 (B:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhklyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1rzgb2:

Click to download the PDB-style file with coordinates for d1rzgb2.
(The format of our PDB-style files is described here.)

Timeline for d1rzgb2: