SCOP 1.71: Domain d1rzga2: 1rzg A:114-214

Lineage for d1rzga2 (1rzg A:114-214)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1rzga2: 1rzg A:114-214 [98155]
   Other proteins in same PDB: d1rzga1, d1rzgb1, d1rzgb2, d1rzgc1, d1rzgd1, d1rzgd2

Details for d1rzga2

PDB Entry: 1rzg, 2 Å

PDB Description: crystal structure of human anti-hiv-1 gp120 reactive antibody 412d

SCOP Domain Sequences for d1rzga2:

Sequence; same for both SEQRES and ATOM records:

>d1rzga2 b.1.1.2 (A:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1rzga2:

• d1rzga2 first appeared in SCOP 1.67
  
• d1rzga2 appears in SCOP 1.69
  
• d1rzga2 appears in SCOP 1.73
  
• d1rzga2 appears in the current release, SCOPe 2.08