SCOPe 2.07: Domain d1rzfl2: 1rzf L:109-210

Lineage for d1rzfl2 (1rzf L:109-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)

8. Domain d1rzfl2: 1rzf L:109-210 [98153]
   Other proteins in same PDB: d1rzfh1, d1rzfh2, d1rzfl1
   part of anti HIV-1 gp120-reactive Fab E51
   complexed with gol, ipa

Details for d1rzfl2

PDB Entry: 1rzf, 1.7 Å

PDB Description: Crystal structure of Human anti-HIV-1 GP120-reactive antibody E51

PDB Compounds: (L:) Fab E51 light chain

SCOPe Domain Sequences for d1rzfl2:

Sequence; same for both SEQRES and ATOM records:

>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d1rzfl2:

• d1rzfl2 first appeared in SCOP 1.67
  
• d1rzfl2 appears in SCOPe 2.06
  
• d1rzfl2 appears in the current release, SCOPe 2.08