Lineage for d1rzfl1 (1rzf L:2-108)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289510Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1289523Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)
  8. 1289525Domain d1rzfl1: 1rzf L:2-108 [98152]
    Other proteins in same PDB: d1rzfh1, d1rzfh2, d1rzfl2
    part of anti HIV-1 gp120-reactive Fab E51
    complexed with gol, ipa

Details for d1rzfl1

PDB Entry: 1rzf (more details), 1.7 Å

PDB Description: Crystal structure of Human anti-HIV-1 GP120-reactive antibody E51
PDB Compounds: (L:) Fab E51 light chain

SCOPe Domain Sequences for d1rzfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
qsiltqppsvsaapgqkvtiscsgsssnignndvswyqqfpgtvpklviyennerpsgip
drfsgsksgtsatlgitglqtgdeadyycgtwdsslsavvfgggskvtvlg

SCOPe Domain Coordinates for d1rzfl1:

Click to download the PDB-style file with coordinates for d1rzfl1.
(The format of our PDB-style files is described here.)

Timeline for d1rzfl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rzfl2