SCOPe 2.08: Domain d1rzfl1: 1rzf L:2-108

Lineage for d1rzfl1 (1rzf L:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 2 [TaxId:9606] [88536] (10 PDB entries)

8. Domain d1rzfl1: 1rzf L:2-108 [98152]
   Other proteins in same PDB: d1rzfh1, d1rzfh2, d1rzfl2
   part of anti HIV-1 gp120-reactive Fab E51
   complexed with gol, ipa

Details for d1rzfl1

PDB Entry: 1rzf, 1.7 Å

PDB Description: Crystal structure of Human anti-HIV-1 GP120-reactive antibody E51

PDB Compounds: (L:) Fab E51 light chain

SCOPe Domain Sequences for d1rzfl1:

Sequence; same for both SEQRES and ATOM records:

>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]}
qsiltqppsvsaapgqkvtiscsgsssnignndvswyqqfpgtvpklviyennerpsgip
drfsgsksgtsatlgitglqtgdeadyycgtwdsslsavvfgggskvtvlg

Timeline for d1rzfl1:

• d1rzfl1 first appeared in SCOP 1.67
  
• d1rzfl1 appears in SCOPe 2.07