Lineage for d1rzfh1 (1rzf H:2-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739829Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 2739830Domain d1rzfh1: 1rzf H:2-113 [98150]
    Other proteins in same PDB: d1rzfh2, d1rzfl1, d1rzfl2
    part of anti HIV-1 gp120-reactive Fab E51
    complexed with gol, ipa

Details for d1rzfh1

PDB Entry: 1rzf (more details), 1.7 Å

PDB Description: Crystal structure of Human anti-HIV-1 GP120-reactive antibody E51
PDB Compounds: (H:) Fab E51 heavy chain

SCOPe Domain Sequences for d1rzfh1:

Sequence, based on SEQRES records: (download)

>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
vqlvqsgaevnkpgssvkvscqasgatlnshafswvrqapgqglewmagiipifgsshya
qkfrgrvtisadestrtvylhlrglrsddtavyycasnsiagvaaagdyadydggyyydm
dvwgqgttvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
vqlvqsgaevnkpgssvkvscqasgatlnshafswvrqapgqglewmagiipifgsshya
qkfrgrvtisadestrtvylhlrglrsddtavyycasnsiaggyyydmdvwgqgttvtvs
s

SCOPe Domain Coordinates for d1rzfh1:

Click to download the PDB-style file with coordinates for d1rzfh1.
(The format of our PDB-style files is described here.)

Timeline for d1rzfh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rzfh2