SCOP 1.67: Domain d1rz8d2: 1rz8 D:114-213

Lineage for d1rz8d2 (1rz8 D:114-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1rz8d2: 1rz8 D:114-213 [98144]
   Other proteins in same PDB: d1rz8a1, d1rz8a2, d1rz8b1, d1rz8c1, d1rz8c2, d1rz8d1
   part of anti HIV-1 gp120-reactive Fab 17B

Details for d1rz8d2

PDB Entry: 1rz8, 2.3 Å

PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 17b

SCOP Domain Sequences for d1rz8d2:

Sequence; same for both SEQRES and ATOM records:

>d1rz8d2 b.1.1.2 (D:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1rz8d2:

• d1rz8d2 is new in SCOP 1.67
  
• d1rz8d2 appears in SCOP 1.69
  
• d1rz8d2 appears in the current release, SCOPe 2.08