Lineage for d1rz8c2 (1rz8 C:110-212)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365640Species Human (Homo sapiens) [TaxId:9606] [88569] (74 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365682Domain d1rz8c2: 1rz8 C:110-212 [98142]
    Other proteins in same PDB: d1rz8a1, d1rz8b1, d1rz8b2, d1rz8c1, d1rz8d1, d1rz8d2
    part of anti HIV-1 gp120-reactive Fab 17B

Details for d1rz8c2

PDB Entry: 1rz8 (more details), 2.3 Å

PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 17b

SCOP Domain Sequences for d1rz8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz8c2 b.1.1.2 (C:110-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1rz8c2:

Click to download the PDB-style file with coordinates for d1rz8c2.
(The format of our PDB-style files is described here.)

Timeline for d1rz8c2: