Lineage for d1rz8a2 (1rz8 A:110-212)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761687Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1761688Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1761770Domain d1rz8a2: 1rz8 A:110-212 [98138]
    Other proteins in same PDB: d1rz8a1, d1rz8b1, d1rz8b2, d1rz8c1, d1rz8d1, d1rz8d2
    part of anti HIV-1 gp120-reactive Fab 17B

Details for d1rz8a2

PDB Entry: 1rz8 (more details), 2.3 Å

PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 17b
PDB Compounds: (A:) Fab 17b light chain

SCOPe Domain Sequences for d1rz8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rz8a2 b.1.1.2 (A:110-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1rz8a2:

Click to download the PDB-style file with coordinates for d1rz8a2.
(The format of our PDB-style files is described here.)

Timeline for d1rz8a2: