SCOPe 2.08: Domain d1rz7h1: 1rz7 H:1-113

Lineage for d1rz7h1 (1rz7 H:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)

8. Domain d1rz7h1: 1rz7 H:1-113 [98133]
   Other proteins in same PDB: d1rz7h2, d1rz7l1, d1rz7l2
   part of anti HIV-1 gp120-reactive Fab 48D
   complexed with gol

Details for d1rz7h1

PDB Entry: 1rz7, 2 Å

PDB Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 48d

PDB Compounds: (H:) Fab 48d heavy chain

SCOPe Domain Sequences for d1rz7h1:

Sequence; same for both SEQRES and ATOM records:

>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
evqlvqsgaevkkpgatvkisckasgytfsdfymywvrqapgkglewmglidpedadtmy
aekfrgrvtitadtstdtgylelsslrsedtavyycaadpwelnafnvwgqgtlvsvss

Timeline for d1rz7h1:

• d1rz7h1 first appeared in SCOP 1.67
  
• d1rz7h1 appears in SCOPe 2.07