SCOPe 2.08: Domain d1ry7b2: 1ry7 B:249-362

Lineage for d1ry7b2 (1ry7 B:249-362)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)

7. Species Human (Homo sapiens), FGFR3c [TaxId:9606] [101514] (1 PDB entry)

8. Domain d1ry7b2: 1ry7 B:249-362 [98093]
   Other proteins in same PDB: d1ry7a_

Details for d1ry7b2

PDB Entry: 1ry7, 3.2 Å

PDB Description: Crystal Structure of the 3 Ig form of FGFR3c in complex with FGF1

PDB Compounds: (B:) Fibroblast growth factor receptor 3

SCOPe Domain Sequences for d1ry7b2:

Sequence; same for both SEQRES and ATOM records:

>d1ry7b2 b.1.1.4 (B:249-362) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR3c [TaxId: 9606]}
sphrpilqaglpanqtavlgsdvefhckvysdaqphiqwlkhvevngskvgpdgtpyvtv
lktaganttdkelevlslhnvtfedageytclagnsigfshhsawlvvlpaeee

Timeline for d1ry7b2:

• d1ry7b2 first appeared in SCOP 1.67
  
• d1ry7b2 appears in SCOPe 2.07