SCOPe 2.08: Domain d1rxha_: 1rxh A:

Lineage for d1rxha_ (1rxh A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d1rxha_: 1rxh A: [98027]
   complexed with bni; mutant

Details for d1rxha_

PDB Entry: 1rxh, 2.9 Å

PDB Description: crystal structure of streptavidin mutant l124r (m1) complexed with biotinyl p-nitroanilide (bni)

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d1rxha_:

Sequence; same for both SEQRES and ATOM records:

>d1rxha_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstrvghdtftk

Timeline for d1rxha_:

• d1rxha_ first appeared in SCOP 1.67
  
• d1rxha_ appears in SCOPe 2.07