Lineage for d1rwfa2 (1rwf A:645-757)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387466Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2387467Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 2387468Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 2387472Protein Chondroitinase AC [49865] (2 species)
  7. 2387473Species Arthrobacter aurescens [TaxId:43663] [101619] (6 PDB entries)
  8. 2387477Domain d1rwfa2: 1rwf A:645-757 [97979]
    Other proteins in same PDB: d1rwfa1, d1rwfa3
    complexed with na, po4

Details for d1rwfa2

PDB Entry: 1rwf (more details), 1.45 Å

PDB Description: crystal structure of arthrobacter aurescens chondroitin ac lyase in complex with chondroitin tetrasaccharide
PDB Compounds: (A:) chondroitin AC lyase

SCOPe Domain Sequences for d1rwfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwfa2 b.24.1.1 (A:645-757) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]}
kysvirndataqsvefktakttaatfwkpgmagdlgasgpacvvfsrhgnelslavsept
qkaagltltlpegtwssvlegagtlgtdadgrstltldttglsgktkliklkr

SCOPe Domain Coordinates for d1rwfa2:

Click to download the PDB-style file with coordinates for d1rwfa2.
(The format of our PDB-style files is described here.)

Timeline for d1rwfa2: