Lineage for d1rvxd_ (1rvx D:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431801Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 431802Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 431803Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 431804Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 431805Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)
  8. 431817Domain d1rvxd_: 1rvx D: [97940]
    Other proteins in same PDB: d1rvxa_, d1rvxc_, d1rvxe_, d1rvxg_, d1rvxi_, d1rvxk_

Details for d1rvxd_

PDB Entry: 1rvx (more details), 2.2 Å

PDB Description: 1934 h1 hemagglutinin in complex with lsta

SCOP Domain Sequences for d1rvxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvxd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp

SCOP Domain Coordinates for d1rvxd_:

Click to download the PDB-style file with coordinates for d1rvxd_.
(The format of our PDB-style files is described here.)

Timeline for d1rvxd_: