![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein Hypothetical protein Atu3453 [102949] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [102950] (1 PDB entry) |
![]() | Domain d1rvka2: 1rvk A:1-126 [97929] Other proteins in same PDB: d1rvka1 structural genomics |
PDB Entry: 1rvk (more details), 1.7 Å
SCOP Domain Sequences for d1rvka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rvka2 d.54.1.1 (A:1-126) Hypothetical protein Atu3453 {Agrobacterium tumefaciens} miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv ykligg
Timeline for d1rvka2: