Lineage for d1rvka2 (1rvk A:1-126)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503550Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 503551Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 503552Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 503638Protein Hypothetical protein Atu3453 [102949] (1 species)
  7. 503639Species Agrobacterium tumefaciens [TaxId:358] [102950] (1 PDB entry)
  8. 503640Domain d1rvka2: 1rvk A:1-126 [97929]
    Other proteins in same PDB: d1rvka1
    structural genomics

Details for d1rvka2

PDB Entry: 1rvk (more details), 1.7 Å

PDB Description: crystal structure of enolase agr_l_2751 from agrobacterium tumefaciens

SCOP Domain Sequences for d1rvka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvka2 d.54.1.1 (A:1-126) Hypothetical protein Atu3453 {Agrobacterium tumefaciens}
miitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrph
viekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpv
ykligg

SCOP Domain Coordinates for d1rvka2:

Click to download the PDB-style file with coordinates for d1rvka2.
(The format of our PDB-style files is described here.)

Timeline for d1rvka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rvka1