SCOP 1.75: Domain d1rvjh1: 1rvj H:36-248

Lineage for d1rvjh1 (1rvj H:36-248)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
   Uniprot P11846

8. Domain d1rvjh1: 1rvj H:36-248 [97924]
   Other proteins in same PDB: d1rvjh2, d1rvjl_, d1rvjm_
   complexed with bcl, bph, cdl, fe2, lda, po4, spo, u10; mutant

Details for d1rvjh1

PDB Entry: 1rvj, 2.75 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg h177 replaced with his

PDB Compounds: (H:) reaction center protein h chain

SCOP Domain Sequences for d1rvjh1:

Sequence; same for both SEQRES and ATOM records:

>d1rvjh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmahflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

Timeline for d1rvjh1:

• d1rvjh1 first appeared in SCOP 1.67
  
• d1rvjh1 appears in SCOP 1.73
  
• d1rvjh1 appears in SCOPe 2.01
  
• d1rvjh1 appears in the current release, SCOPe 2.08