Lineage for d1rv0l_ (1rv0 L:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778235Domain d1rv0l_: 1rv0 L: [97899]
    Other proteins in same PDB: d1rv0i_, d1rv0k_, d1rv0m_
    1930 swine H1
    complexed with dan, ndg

Details for d1rv0l_

PDB Entry: 1rv0 (more details), 2.5 Å

PDB Description: 1930 swine h1 hemagglutinin complexed with lsta
PDB Compounds: (L:) Hemagglutinin

SCOPe Domain Sequences for d1rv0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv0l_ b.19.1.2 (L:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
llgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
hpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllepgdti
tfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnihpvti
gecpkyvkstklrmatglrnipar

SCOPe Domain Coordinates for d1rv0l_:

Click to download the PDB-style file with coordinates for d1rv0l_.
(The format of our PDB-style files is described here.)

Timeline for d1rv0l_: