Lineage for d1ruyk_ (1ruy K:)

  1. Root: SCOPe 2.01
  2. 1067937Class h: Coiled coil proteins [57942] (7 folds)
  3. 1069044Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1069045Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1069046Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1069047Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1069048Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 1069108Domain d1ruyk_: 1ruy K: [97886]
    Other proteins in same PDB: d1ruyh_, d1ruyj_, d1ruyl_
    1930 swine H1
    complexed with nag, ndg

Details for d1ruyk_

PDB Entry: 1ruy (more details), 2.7 Å

PDB Description: 1930 swine h1 hemagglutinin
PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d1ruyk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruyk_ h.3.1.1 (K:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnklekrienlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
kvrsqlknnakeigngcfefyhkcdnecmesvrngtydyp

SCOPe Domain Coordinates for d1ruyk_:

Click to download the PDB-style file with coordinates for d1ruyk_.
(The format of our PDB-style files is described here.)

Timeline for d1ruyk_: