SCOP 1.67: Domain d1ruql2: 1ruq L:108-212

Lineage for d1ruql2 (1ruq L:108-212)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1ruql2: 1ruq L:108-212 [97878]
   Other proteins in same PDB: d1ruqh1, d1ruqh2, d1ruql1
   part of Diels-Alder catalytic Fab 13G5
   complexed with zn

Details for d1ruql2

PDB Entry: 1ruq, 1.86 Å

PDB Description: Crystal Structure (H) of u.v.-irradiated Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set collected in house.

SCOP Domain Sequences for d1ruql2:

Sequence; same for both SEQRES and ATOM records:

>d1ruql2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
tkdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1ruql2:

• d1ruql2 is new in SCOP 1.67
  
• d1ruql2 appears in SCOP 1.69
  
• d1ruql2 appears in the current release, SCOPe 2.08