Lineage for d1ruqh2 (1ruq H:114-227)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292198Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1292510Species Mouse (Mus musculus) [TaxId:10090] [88576] (414 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1292563Domain d1ruqh2: 1ruq H:114-227 [97876]
    Other proteins in same PDB: d1ruqh1, d1ruql1, d1ruql2
    part of Diels-Alder catalytic Fab 13G5
    complexed with zn

Details for d1ruqh2

PDB Entry: 1ruq (more details), 1.86 Å

PDB Description: Crystal Structure (H) of u.v.-irradiated Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set collected in house.
PDB Compounds: (H:) immunoglobulin 13G5 heavy chain

SCOPe Domain Sequences for d1ruqh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruqh2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOPe Domain Coordinates for d1ruqh2:

Click to download the PDB-style file with coordinates for d1ruqh2.
(The format of our PDB-style files is described here.)

Timeline for d1ruqh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ruqh1