Lineage for d1ruqh2 (1ruq H:114-227)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655389Domain d1ruqh2: 1ruq H:114-227 [97876]
    Other proteins in same PDB: d1ruqh1, d1ruql1, d1ruql2
    part of Diels-Alder catalytic Fab 13G5
    complexed with zn

Details for d1ruqh2

PDB Entry: 1ruq (more details), 1.86 Å

PDB Description: Crystal Structure (H) of u.v.-irradiated Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set collected in house.
PDB Compounds: (H:) immunoglobulin 13G5 heavy chain

SCOP Domain Sequences for d1ruqh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruqh2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1ruqh2:

Click to download the PDB-style file with coordinates for d1ruqh2.
(The format of our PDB-style files is described here.)

Timeline for d1ruqh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ruqh1