SCOP 1.71: Domain d1ruqh2: 1ruq H:114-227

Lineage for d1ruqh2 (1ruq H:114-227)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1ruqh2: 1ruq H:114-227 [97876]
   Other proteins in same PDB: d1ruqh1, d1ruql1, d1ruql2
   part of Diels-Alder catalytic Fab 13G5
   complexed with zn

Details for d1ruqh2

PDB Entry: 1ruq, 1.86 Å

PDB Description: Crystal Structure (H) of u.v.-irradiated Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set collected in house.

SCOP Domain Sequences for d1ruqh2:

Sequence; same for both SEQRES and ATOM records:

>d1ruqh2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Timeline for d1ruqh2:

• d1ruqh2 first appeared in SCOP 1.67
  
• d1ruqh2 appears in SCOP 1.69
  
• d1ruqh2 appears in SCOP 1.73
  
• d1ruqh2 appears in the current release, SCOPe 2.08