SCOP 1.73: Domain d1ruqh1: 1ruq H:1-113

Lineage for d1ruqh1 (1ruq H:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1ruqh1: 1ruq H:1-113 [97875]
   Other proteins in same PDB: d1ruqh2, d1ruql1, d1ruql2
   part of Diels-Alder catalytic Fab 13G5
   complexed with zn

Details for d1ruqh1

PDB Entry: 1ruq, 1.86 Å

PDB Description: Crystal Structure (H) of u.v.-irradiated Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set collected in house.

PDB Compounds: (H:) immunoglobulin 13G5 heavy chain

SCOP Domain Sequences for d1ruqh1:

Sequence; same for both SEQRES and ATOM records:

>d1ruqh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqleesgpelvrpgtsvkisckasgytftnywlgwvkqrpghgfewigdiypggvyttn
nekfrgkailtadtssstaymqlssltsedsavyfcaraggyytggdywgqgtsvtvss

Timeline for d1ruqh1:

• d1ruqh1 first appeared in SCOP 1.67
  
• d1ruqh1 appears in SCOP 1.71
  
• d1ruqh1 appears in SCOP 1.75
  
• d1ruqh1 appears in the current release, SCOPe 2.08