SCOP 1.73: Domain d1rupl1: 1rup L:1-107

Lineage for d1rupl1 (1rup L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1rupl1: 1rup L:1-107 [97873]
   Other proteins in same PDB: d1ruph1, d1ruph2, d1rupl2
   part of cationic cyclization catalytic Fab 4C6
   complexed with bez, gol

Details for d1rupl1

PDB Entry: 1rup, 1.4 Å

PDB Description: crystal structure (g) of native cationic cyclization antibody 4c6 fab at ph 8.5 with a data set collected at aps beamline 19-id

PDB Compounds: (L:) immunoglobulin igg2a, heavy chain

SCOP Domain Sequences for d1rupl1:

Sequence; same for both SEQRES and ATOM records:

>d1rupl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleik

Timeline for d1rupl1:

• d1rupl1 first appeared in SCOP 1.67
  
• d1rupl1 appears in SCOP 1.71
  
• d1rupl1 appears in SCOP 1.75
  
• d1rupl1 appears in the current release, SCOPe 2.08