Lineage for d1ruph1 (1rup H:1-113)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104233Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (38 PDB entries)
    Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor
  8. 1104236Domain d1ruph1: 1rup H:1-113 [97871]
    Other proteins in same PDB: d1ruph2, d1rupl1, d1rupl2
    part of cationic cyclization catalytic Fab 4C6
    complexed with bez, gol

Details for d1ruph1

PDB Entry: 1rup (more details), 1.4 Å

PDB Description: crystal structure (g) of native cationic cyclization antibody 4c6 fab at ph 8.5 with a data set collected at aps beamline 19-id
PDB Compounds: (H:) immunoglobulin igg2a, light chain

SCOPe Domain Sequences for d1ruph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruph1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsa

SCOPe Domain Coordinates for d1ruph1:

Click to download the PDB-style file with coordinates for d1ruph1.
(The format of our PDB-style files is described here.)

Timeline for d1ruph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ruph2