Lineage for d1rull2 (1rul L:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656178Domain d1rull2: 1rul L:108-214 [97866]
    Other proteins in same PDB: d1rulh1, d1rulh2, d1rull1
    part of cationic cyclization catalytic Fab 4C6
    complexed with 4ht, act, bez, ghg, gol

Details for d1rull2

PDB Entry: 1rul (more details), 1.88 Å

PDB Description: crystal structure (d) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 5.6 with a data set collected at ssrl beamline 11-1.
PDB Compounds: (L:) immunoglobulin igg2a, light chain

SCOP Domain Sequences for d1rull2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rull2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1rull2:

Click to download the PDB-style file with coordinates for d1rull2.
(The format of our PDB-style files is described here.)

Timeline for d1rull2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rull1