Lineage for d1rulh1 (1rul H:1-113)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547188Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (34 PDB entries)
  8. 547196Domain d1rulh1: 1rul H:1-113 [97863]
    Other proteins in same PDB: d1rulh2, d1rull1, d1rull2
    part of cationic cyclization catalytic Fab 4C6
    complexed with 4ht, act, bez, ghg, gol

Details for d1rulh1

PDB Entry: 1rul (more details), 1.88 Å

PDB Description: crystal structure (d) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 5.6 with a data set collected at ssrl beamline 11-1.

SCOP Domain Sequences for d1rulh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rulh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsa

SCOP Domain Coordinates for d1rulh1:

Click to download the PDB-style file with coordinates for d1rulh1.
(The format of our PDB-style files is described here.)

Timeline for d1rulh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rulh2