SCOP 1.71: Domain d1ru9h1: 1ru9 H:1-113

Lineage for d1ru9h1 (1ru9 H:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (34 PDB entries)

8. Domain d1ru9h1: 1ru9 H:1-113 [97851]
   Other proteins in same PDB: d1ru9h2, d1ru9l1, d1ru9l2
   part of cationic cyclization catalytic Fab 4C6
   complexed with 4ht, act, bez, ghg, gol

Details for d1ru9h1

PDB Entry: 1ru9, 2.5 Å

PDB Description: Crystal Structure (A) of u.v.-irradiated cationic cyclization antibody 4C6 Fab at pH 4.6 with a data set collected in-house.

SCOP Domain Sequences for d1ru9h1:

Sequence; same for both SEQRES and ATOM records:

>d1ru9h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsa

Timeline for d1ru9h1:

• d1ru9h1 first appeared in SCOP 1.67
  
• d1ru9h1 appears in SCOP 1.69
  
• d1ru9h1 appears in SCOP 1.73
  
• d1ru9h1 appears in the current release, SCOPe 2.08