Lineage for d1ru7j_ (1ru7 J:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431801Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 431802Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 431803Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 431804Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 431805Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)
  8. 431880Domain d1ru7j_: 1ru7 J: [97846]
    Other proteins in same PDB: d1ru7a_, d1ru7c_, d1ru7e_, d1ru7g_, d1ru7i_, d1ru7k_

Details for d1ru7j_

PDB Entry: 1ru7 (more details), 2.3 Å

PDB Description: 1934 Human H1 Hemagglutinin

SCOP Domain Sequences for d1ru7j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ru7j_ h.3.1.1 (J:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp

SCOP Domain Coordinates for d1ru7j_:

Click to download the PDB-style file with coordinates for d1ru7j_.
(The format of our PDB-style files is described here.)

Timeline for d1ru7j_: