SCOP 1.73: Domain d1rtyc_: 1rty C:

Lineage for d1rtyc_ (1rty C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (2 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.2: Cobalamin adenosyltransferase [89032] (2 proteins)

6. Protein Putative ATP-binding cobalamin adenosyltransferase YvqK [101138] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101139] (1 PDB entry)

8. Domain d1rtyc_: 1rty C: [97830]
   structural genomics; NESG target SR128
   complexed with po4

Details for d1rtyc_

PDB Entry: 1rty, 2.4 Å

PDB Description: Crystal Structure of Bacillus subtilis YvqK, a putative ATP-binding Cobalamin Adenosyltransferase, The North East Structural Genomics Target SR128

PDB Compounds: (C:) yvqk protein

SCOP Domain Sequences for d1rtyc_:

Sequence, based on SEQRES records:

>d1rtyc_ a.25.2.2 (C:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis [TaxId: 1423]}
kdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaivterk
dyklteesvsfletridaytaeapelkkfilpggskcasllhiartitrraerrvvalmk
seeihetvlrylnrlsdyffagarvvnarsgigdveyersaivfrdrns

Sequence, based on observed residues (ATOM records):

>d1rtyc_ a.25.2.2 (C:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis [TaxId: 1423]}
kdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaykltee
svsfletridaytaeapelkkfilpggskcasllhiartitrraerrvvalmkseeihet
vlrylnrlsdyffagarvvnarsgigdveyersaivfrdrns

Timeline for d1rtyc_:

• d1rtyc_ first appeared in SCOP 1.67
  
• d1rtyc_ appears in SCOP 1.71
  
• d1rtyc_ appears in SCOP 1.75
  
• d1rtyc_ appears in the current release, SCOPe 2.08