Lineage for d1rtya_ (1rty A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1730363Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 1730368Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 proteins)
    automatically mapped to Pfam PF01923
  6. 1730372Protein Putative ATP-binding cobalamin adenosyltransferase YvqK [101138] (1 species)
  7. 1730373Species Bacillus subtilis [TaxId:1423] [101139] (1 PDB entry)
  8. 1730374Domain d1rtya_: 1rty A: [97828]
    structural genomics; NESG target SR128
    complexed with po4

Details for d1rtya_

PDB Entry: 1rty (more details), 2.4 Å

PDB Description: Crystal Structure of Bacillus subtilis YvqK, a putative ATP-binding Cobalamin Adenosyltransferase, The North East Structural Genomics Target SR128
PDB Compounds: (A:) yvqk protein

SCOPe Domain Sequences for d1rtya_:

Sequence, based on SEQRES records: (download)

>d1rtya_ a.25.2.2 (A:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis [TaxId: 1423]}
kdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaivterk
dyklteesvsfletridaytaeapelkkfilpggskcasllhiartitrraerrvvalmk
seeihetvlrylnrlsdyffagarvvnarsgigdveyersa

Sequence, based on observed residues (ATOM records): (download)

>d1rtya_ a.25.2.2 (A:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis [TaxId: 1423]}
kdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaivtdyk
lteesvsfletridaytaeapelkkfilpggskcasllhiartitrraerrvvalmksee
ihetvlrylnrlsdyffagarvvnarsgigdveyersa

SCOPe Domain Coordinates for d1rtya_:

Click to download the PDB-style file with coordinates for d1rtya_.
(The format of our PDB-style files is described here.)

Timeline for d1rtya_: