Lineage for d1rtqa_ (1rtq A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488901Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 489247Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 489335Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (9 proteins)
  6. 489340Protein Aminopeptidase [53205] (2 species)
  7. 489341Species Aeromonas proteolytica [TaxId:671] [53206] (7 PDB entries)
    synonym: Vibrio proteolyticus
  8. 489342Domain d1rtqa_: 1rtq A: [97819]

Details for d1rtqa_

PDB Entry: 1rtq (more details), 0.95 Å

PDB Description: The 0.95 Angstrom Resolution Crystal Structure of the Aminopeptidase from Aeromonas proteolytica

SCOP Domain Sequences for d1rtqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtqa_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

SCOP Domain Coordinates for d1rtqa_:

Click to download the PDB-style file with coordinates for d1rtqa_.
(The format of our PDB-style files is described here.)

Timeline for d1rtqa_: