SCOP 1.67: Domain d1rtqa_: 1rtq A:

Lineage for d1rtqa_ (1rtq A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (9 proteins)

6. Protein Aminopeptidase [53205] (2 species)

7. Species Aeromonas proteolytica [TaxId:671] [53206] (6 PDB entries)
   synonym: Vibrio proteolyticus

8. Domain d1rtqa_: 1rtq A: [97819]
   complexed with na, scn, zn

Details for d1rtqa_

PDB Entry: 1rtq, 0.95 Å

PDB Description: The 0.95 Angstrom Resolution Crystal Structure of the Aminopeptidase from Aeromonas proteolytica

SCOP Domain Sequences for d1rtqa_:

Sequence; same for both SEQRES and ATOM records:

>d1rtqa_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica}
mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl
pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas
giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm
tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa
ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg

Timeline for d1rtqa_:

• d1rtqa_ is new in SCOP 1.67
  
• d1rtqa_ appears in SCOP 1.69
  
• d1rtqa_ appears in the current release, SCOPe 2.08