![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (6 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (9 proteins) |
![]() | Protein Aminopeptidase [53205] (2 species) |
![]() | Species Aeromonas proteolytica [TaxId:671] [53206] (6 PDB entries) synonym: Vibrio proteolyticus |
![]() | Domain d1rtqa_: 1rtq A: [97819] complexed with na, scn, zn |
PDB Entry: 1rtq (more details), 0.95 Å
SCOP Domain Sequences for d1rtqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtqa_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica} mppitqqatvtawlpqvdasqitgtisslesftnrfytttsgaqasdwiasewqalsasl pnasvkqvshsgynqksvvmtitgseapdewivigghldstigshtneqsvapgadddas giaavtevirvlsennfqpkrsiafmayaaeevglrgsqdlanqyksegknvvsalqldm tnykgsaqdvvfitdytdsnftqyltqlmdeylpsltygfdtcgyacsdhaswhnagypa ampfeskfndynprihttqdtlansdptgshakkftqlglayaiemgsatg
Timeline for d1rtqa_: